Mouse Anti-Cat CYP24A1 Antibody (MO-AB-07454W)
Cat: MO-AB-07454W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cat (Felis catus) |
Clone | MO07454W |
Specificity | This antibody binds to Cat CYP24A1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CYP24A1 (Cytochrome P450 Family 24 Subfamily A Member 1) is a Protein Coding gene. Diseases associated with CYP24A1 include Hypercalcemia, Infantile, 1 and Idiopathic Infantile Hypercalcemia. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and heme binding. An important paralog of this gene is CYP27A1. |
Product Overview | Mouse Anti-Cat CYP24A1 Antibody is a mouse antibody against CYP24A1. It can be used for CYP24A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome P450 family 24 subfamily A polypeptide 1; CYP24A1 |
UniProt ID | D2IGW5 |
Protein Refseq | The length of the protein is 30 amino acids long. The sequence is show below: ELYAAVTELQLAAVETTANSLMWILYNLSR. |
See other products for " CYP24A1 "
MO-AB-25029R | Mouse Anti-Pig CYP24A1 Antibody (MO-AB-25029R) |
CBMOAB-72623FYA | Mouse Anti-Zebrafish cyp24a1 Antibody (CBMOAB-72623FYA) |
CBMOAB-40229FYA | Mouse Anti-Rhesus CYP24A1 Antibody (CBMOAB-40229FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry