Mouse Anti-Cat CYP24A1 Antibody (MO-AB-07454W)


Cat: MO-AB-07454W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO07454W
SpecificityThis antibody binds to Cat CYP24A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP24A1 (Cytochrome P450 Family 24 Subfamily A Member 1) is a Protein Coding gene. Diseases associated with CYP24A1 include Hypercalcemia, Infantile, 1 and Idiopathic Infantile Hypercalcemia. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and heme binding. An important paralog of this gene is CYP27A1.
Product OverviewMouse Anti-Cat CYP24A1 Antibody is a mouse antibody against CYP24A1. It can be used for CYP24A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450 family 24 subfamily A polypeptide 1; CYP24A1
UniProt IDD2IGW5
Protein RefseqThe length of the protein is 30 amino acids long.
The sequence is show below: ELYAAVTELQLAAVETTANSLMWILYNLSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry