Mouse Anti-Cat ESR2 Antibody (MO-AB-08193W)


Cat: MO-AB-08193W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08193W
SpecificityThis antibody binds to Cat ESR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized.
Product OverviewMouse Anti-Cat ESR2 Antibody is a mouse antibody against ESR2. It can be used for ESR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEstrogen receptor beta; ESR2
UniProt IDG8BLH6
Protein RefseqThe length of the protein is 409 amino acids long.
The sequence is show below: MDIKNSPSSLNSPASYNCSQPILPLEHGPIYIPSSYVESRHEYSAMTFYSPTVMNYGIPSSASNSEGGPGRQTTSPNVLWPTPGHLSPLAIHCQSSLLYAEPQKSPWCEARSLEPTLPVHRETLKRKVSGSSCASPVTSPSSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRVVRRQKSSEEPLRCASNPKKAGGHVTRVKELLLSALSPEQLVLTLLEAEPPHVLVSRPSTPFTEASMMMSLTKLADKELVHMIGWAKKIPGFVELSLYDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPDLILDRXEGKCVEDSGIFDMLLATTSRFRELKLQHKEYLCVKAMVLLNSSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry