Mouse Anti-Cat GPX3 Antibody (MO-AB-08054W)
Cat: MO-AB-08054W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cat (Felis catus) |
Clone | MO08054W |
Specificity | This antibody binds to Cat GPX3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. |
Product Overview | Mouse Anti-Cat GPX3 Antibody is a mouse antibody against GPX3. It can be used for GPX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glutathione peroxidase; GPX3 |
UniProt ID | M3WHS6 |
Protein Refseq | The length of the protein is 228 amino acids long. The sequence is show below: MARLLRASCLLSLLLAGFVPPSRGQEKSKTDCHAGGSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYFLLCSMCPELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPSLKHVRPGGGFVPNFQLFEKGDVNGEKERLTPVSSLLQNSCPPTSELLGSPNRLFWEPMKVHDIRWNFEKFLVGPDGVPLMRWYHRTTVSTVKMDILAYMRRQAALTVNGK. |
See other products for " GPX3 "
CBMOAB-34190FYC | Mouse Anti-Arabidopsis GPX3 Antibody (CBMOAB-34190FYC) |
MO-DKB-01998W | Rabbit Anti-GPX3 Antibody (MO-DKB-01998W) |
MO-AB-31015W | Mouse Anti-Dog GPX3 Antibody (MO-AB-31015W) |
MO-AB-02215Y | Mouse Anti-Chicken GPX3 Antibody (MO-AB-02215Y) |
CBMOAB-44071FYA | Mouse Anti-Rhesus GPX3 Antibody (CBMOAB-44071FYA) |
CBMOAB-78576FYA | Mouse Anti-Zebrafish gpx3 Antibody (CBMOAB-78576FYA) |
MO-AB-13332R | Mouse Anti-Cattle GPX3 Antibody (MO-AB-13332R) |
MO-AB-56325W | Mouse Anti-Marmoset GPX3 Antibody (MO-AB-56325W) |
MO-DKB-01997W | Rabbit Anti-GPX3 Antibody (MO-DKB-01997W) |
CBMOAB-04657HCB | Mouse Anti-C. elegans GPX3 Antibody (CBMOAB-04657HCB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry