Mouse Anti-Cat GPX3 Antibody (MO-AB-08054W)


Cat: MO-AB-08054W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08054W
SpecificityThis antibody binds to Cat GPX3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Cat GPX3 Antibody is a mouse antibody against GPX3. It can be used for GPX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione peroxidase; GPX3
UniProt IDM3WHS6
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MARLLRASCLLSLLLAGFVPPSRGQEKSKTDCHAGGSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYFLLCSMCPELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPSLKHVRPGGGFVPNFQLFEKGDVNGEKERLTPVSSLLQNSCPPTSELLGSPNRLFWEPMKVHDIRWNFEKFLVGPDGVPLMRWYHRTTVSTVKMDILAYMRRQAALTVNGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry