AibGenesis™ Mouse Anti-Ly49 Antibody (MO-AB-09053W)


Cat: MO-AB-09053W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09053W Monoclonal Cat (Felis catus), Dog (Canis lupus familiaris), Pig (Sus scrofa) WB, ELISA MO09053W 100 µg
MO-AB-27079R Monoclonal Pig (Sus scrofa) WB, ELISA MO27079R 100 µg
MO-AB-31644W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31644W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Dog (Canis lupus familiaris), Pig (Sus scrofa)
CloneMO09053W
SpecificityThis antibody binds to Cat Ly49.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat Ly49 Antibody is a mouse antibody against Ly49. It can be used for Ly49 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLy49
UniProt IDQ863K4
Protein RefseqThe length of the protein is 273 amino acids long.
The sequence is show below: MSDQKVIYSTLRFLQSPSESQNIIRPGRTQRPGKTDEKEFSVPWHLIAVILGILCFLLLVTVAVLGTKIFQYIQENHQQRQNIRNLSQEYQIVQNDSYFKEQLLTNKILECNSRENESLQQKMKQDFIERTCQRKNIGKLYESHWSCCGIKCYYFIPEYKNWKGCKQTCQSYNSFLLKINDQDELTFIQTQTYRNYYWIGLSYNGGERKWKWIDSDPLLGMHYAFMNISGRGQCAFLSSTRITNTECSQMYNCICEKTIGDIFFPSFNNYKKI.
For Research Use Only | Not For Clinical Use.
Online Inquiry