Mouse Anti-Cat MT-CYB Antibody (MO-AB-09245W)


Cat: MO-AB-09245W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO09245W
SpecificityThis antibody binds to Cat MT-CYB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMT-CYB (Mitochondrially Encoded Cytochrome B) is a Protein Coding gene. Diseases associated with MT-CYB include Cardiomyopathy, Infantile Histiocytoid and Mitochondrial Encephalomyopathy. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Metabolism. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and ubiquinol-cytochrome-c reductase activity.
Product OverviewMouse Anti-Cat MT-CYB Antibody is a mouse antibody against MT-CYB. It can be used for MT-CYB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; MT-CYB; COB CYTB MTCYB
UniProt IDP48886
Protein RefseqThe length of the protein is 379 amino acids long.
The sequence is show below: MTNIRKSHPLIKIINHSFIDLPAPSNISAWWNFGSLLGVCLTLQILTGLFLAMHYTSDTMTAFSSVTHICRDVNYGWIIRYLHANGASMFFICLYMHVGRGMYYGSYTFSETWNIGIMLLFTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTELVEWIWGGFSVDKATLTRFFGFHFILPFIISALAGVHLLFLHETGSNNPSGITSDSDKIPFHPYYTIKDILGLLVLVLTLMLLVLFSPDLLGDPDNYIPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILVLAIIPILHTSKQRGMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFITIGQLASILYFSTLLILMPISGIIENRLLKW.
For Research Use Only | Not For Clinical Use.
Online Inquiry