Mouse Anti-Cat PGD Antibody (MO-AB-08033W)


Cat: MO-AB-08033W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08033W
SpecificityThis antibody binds to Cat PGD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introduction6-phosphogluconate dehydrogenase is the second dehydrogenase in the pentose phosphate shunt. Deficiency of this enzyme is generally asymptomatic, and the inheritance of this disorder is autosomal dominant. Hemolysis results from combined deficiency of 6-phosphogluconate dehydrogenase and 6-phosphogluconolactonase suggesting a synergism of the two enzymopathies. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cat PGD Antibody is a mouse antibody against PGD. It can be used for PGD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44; PGD
UniProt IDM3WKZ2
Protein RefseqThe length of the protein is 483 amino acids long.
The sequence is show below: MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGARSLEEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRTLKAKGILFVGSGVSGGEEGARYGPSLMPGGDKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLDMGHDEMAKAFEEWNKTELDSFLIEITANILKFQDSDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERVQASQKLKGPQKIQFEGDKKSFLEDIQKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPHLQNLLLDDFFKSAVENCQDSWRRTVSTGVRAGIPMPCFTTALSFYDGYRHETLPANLIQAQRDYFGAHTYELLANPGRFVHTNWTGHGGSVSSSSYNA.
See other products for " PGD "
MO-AB-32687WMouse Anti-Dog PGD Antibody (MO-AB-32687W)
MO-AB-06203HMouse Anti-Frog pgd Antibody (MO-AB-06203H)
MO-AB-17055YMouse Anti-Sheep PGD Antibody (MO-AB-17055Y)
MO-AB-61373WMouse Anti-Marmoset PGD Antibody (MO-AB-61373W)
MO-AB-28228RMouse Anti-Pig PGD Antibody (MO-AB-28228R)
MO-AB-23589HMouse Anti-Mallard PGD Antibody (MO-AB-23589H)
MO-AB-42306WMouse Anti-Guinea pig PGD Antibody (MO-AB-42306W)
MO-AB-17820RMouse Anti-Cattle PGD Antibody (MO-AB-17820R)
MO-AB-46013WMouse Anti-Horse PGD Antibody (MO-AB-46013W)
MO-AB-06758YMouse Anti-O. anatinus PGD Antibody (MO-AB-06758Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry