AibGenesis™ Mouse Anti-PGFS Antibody (MO-AB-07333W)


Cat: MO-AB-07333W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07333W Monoclonal Cat (Felis catus), Dog (Canis lupus familiaris), Horse (Equus caballus) WB, ELISA MO07333W 100 µg
MO-AB-32688W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32688W 100 µg
MO-AB-46014W Monoclonal Horse (Equus caballus) WB, ELISA MO46014W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Dog (Canis lupus familiaris), Horse (Equus caballus)
CloneMO07333W
SpecificityThis antibody binds to Cat PGFS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat PGFS Antibody is a mouse antibody against PGFS. It can be used for PGFS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProstaglandin F2 alpha synthase; PGFS
UniProt IDE2IGW3
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: AMEKCKDSGLAKSIGVSNFNHKQLERILDKPGLKYKPVCNQVECHPYLNQSKLLEFCKSQDIVLTAYAALGSNSGKEWLSKNNPVLLEDPVLSAIAARHRRTPAQVALRYQLQRGVVALAKSFNEERIRENFQV.
For Research Use Only | Not For Clinical Use.
Online Inquiry