Mouse Anti-Cattle ABCB8 Antibody (MO-AB-06754R)


Cat: MO-AB-06754R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06754R
SpecificityThis antibody binds to Cattle ABCB8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis nuclear gene encodes a multi-pass membrane protein that is targeted to the mitochondrial inner membrane. The encoded protein is an ATP-dependent transporter that may mediate the passage of organic and inorganic molecules out of the mitochondria. Loss of function of the related gene in mouse results in a disruption of iron homeostasis between the mitochondria and cytosol. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle ABCB8 Antibody is a mouse antibody against ABCB8. It can be used for ABCB8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette, sub-family B, member 8; ABCB8
UniProt IDQ1JPH5
Protein RefseqThe length of the protein is 461 amino acids long.
The sequence is show below: MLVHLFRVGIRGGPVPGKPLLPLRFQTFSAVRSSDGRPSACLLGVMAQLRSQLRARLPRAAPAPIRSPSAWRWVGGVLLGPLVLSKCPRLSLVALCEAEEAPLARSRPRVLEPRFNWTLFWQFLRPHLLVLGAAIVLALGAALVNVQIPLLLGQLVEIVAKYTRDHAGSFLTESRSLSTHLLLLYGLQGLLTFGYLVLLSRIGERMAVDLRRALFCNLLRQDIEFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry