Mouse Anti-Cattle ABLIM3 Antibody (MO-AB-06815R)


Cat: MO-AB-06815R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06815R
SpecificityThis antibody binds to Cattle ABLIM3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the actin-binding LIM (abLIM) family of proteins. These proteins are characterized by an N-terminal LIM domain and a C-terminal dematin-like domain. The encoded protein interacts with actin filaments and may be a component of adherens junctions in several cell types. A variant of this gene may be associated with pain sensitivity in male human patients.
Product OverviewMouse Anti-Cattle ABLIM3 Antibody is a mouse antibody against ABLIM3. It can be used for ABLIM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesABLIM3 protein; ABLIM3
UniProt IDA5PKK3
Protein RefseqThe length of the protein is 683 amino acids long.
The sequence is show below: MNTSLPYQQNPYSPRGSSNVIQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCKKPFPIGDKVTFSGKECLCQTCSQSMTSSKPIKIRGPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVILTGEYISKDGVPYCESDYHSQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSE.
For Research Use Only | Not For Clinical Use.
Online Inquiry