Mouse Anti-Cattle ACIN1 Antibody (MO-AB-06885R)


Cat: MO-AB-06885R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06885R
SpecificityThis antibody binds to Cattle ACIN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionApoptosis is defined by several morphologic nuclear changes, including chromatin condensation and nuclear fragmentation. This gene encodes a nuclear protein that induces apoptotic chromatin condensation after activation by caspase-3, without inducing DNA fragmentation. This protein has also been shown to be a component of a splicing-dependent multiprotein exon junction complex (EJC) that is deposited at splice junctions on mRNAs, as a consequence of pre-mRNA splicing. It may thus be involved in mRNA metabolism associated with splicing. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product OverviewMouse Anti-Cattle ACIN1 Antibody is a mouse antibody against ACIN1. It can be used for ACIN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACIN1 protein, Fragment; ACIN1
UniProt IDA4FUB9
Protein RefseqThe length of the protein is 701 amino acids long.
The sequence is show below: RSRSRSRSASSNSRKSLSPGVSRDSSTSYTETKDPSSGQEVAAPPLPQLQVLEPKERTSTPSSVQVRLVSQPEPAAKHVTQRLQPDRGSPKKCEAEEAEPPAATQPQTSETPTSHLPESERIHHTVEEKEEVTMDTSENRPENEVPEPPMPIADQVSNDDRPEGNAEDEEKKESLLPKSFKRKISVVSATKGVPAGNSDTEGGQPSRKRRWGASTATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDS.
See other products for " ACIN1 "
MO-AB-24309WMouse Anti-Chimpanzee ACIN1 Antibody (MO-AB-24309W)
CBMOAB-00268HCBMouse Anti-C. elegans ACIN1 Antibody (CBMOAB-00268HCB)
MO-AB-00907WMouse Anti-Rhesus ACIN1 Antibody (MO-AB-00907W)
CBMOAB-34956FYAMouse Anti-Rhesus ACIN1 Antibody (CBMOAB-34956FYA)
MO-AB-01171HMouse Anti-Frog acin1 Antibody (MO-AB-01171H)
MO-AB-26607WMouse Anti-Chimpanzee ACIN1 Antibody (MO-AB-26607W)
MO-AB-50318WMouse Anti-Marmoset ACIN1 Antibody (MO-AB-50318W)
For Research Use Only | Not For Clinical Use.
Online Inquiry