Mouse Anti-Cattle ACO2 Antibody (MO-AB-06895R)


Cat: MO-AB-06895R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06895R
SpecificityThis antibody binds to Cattle ACO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the aconitase/IPM isomerase family. It is an enzyme that catalyzes the interconversion of citrate to isocitrate via cis-aconitate in the second step of the TCA cycle. This protein is encoded in the nucleus and functions in the mitochondrion. It was found to be one of the mitochondrial matrix proteins that are preferentially degraded by the serine protease 15(PRSS15), also known as Lon protease, after oxidative modification.
Product OverviewMouse Anti-Cattle ACO2 Antibody is a mouse antibody against ACO2. It can be used for ACO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAconitate hydratase, mitochondrial; Aconitase; EC 4.2.1.3; Citrate hydro-lyase; ACO2
UniProt IDP20004
Protein RefseqThe length of the protein is 780 amino acids long.
The sequence is show below: MAPYSLLVSRLQKALGARQYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKVAGIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry