Mouse Anti-Cattle ACP2 Antibody (MO-AB-06911R)


Cat: MO-AB-06911R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06911R
SpecificityThis antibody binds to Cattle ACP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationLysosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the histidine acid phosphatase family, which hydrolyze orthophosphoric monoesters to alcohol and phosphate. This protein is localized to the lysosomal membrane, and is chemically and genetically distinct from the red cell acid phosphatase. Mice lacking this gene showed multiple defects, including bone structure alterations, lysosomal storage defects, and an increased tendency towards seizures. An enzymatically-inactive allele of this gene in mice showed severe growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype. Alternatively spliced transcript variants have been found for this gene. A C-terminally extended isoform is also predicted to be produced by the use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism.
Product OverviewMouse Anti-Cattle ACP2 Antibody is a mouse antibody against ACP2. It can be used for ACP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLysosomal acid phosphatase; LAP; EC 3.1.3.2; ACP2
UniProt IDQ0P5F0
Protein RefseqThe length of the protein is 423 amino acids long.
The sequence is show below: MAGRRFGWSRAALLQLILGVNLMVMPRTQARTLRFVTLLYRHGDRSPVKAYPKDPHQEDKWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPDGIQRFNPNISWQPIPVHTVPVAEDRLLKFPLGPCPRFEQLQNETRRMPEYQNESVQNAQFLDMVANETGLTDLSLETVWNVYDTLFCEQTHGLPLPPWASPQTMQRLSRLKDFSFRFLFGIYKQAEKARL.
For Research Use Only | Not For Clinical Use.
Online Inquiry