Mouse Anti-Cattle ACSF3 Antibody (MO-AB-06922R)


Cat: MO-AB-06922R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06922R
SpecificityThis antibody binds to Cattle ACSF3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the acyl-CoA synthetase family of enzymes that activate fatty acids by catalyzing the formation of a thioester linkage between fatty acids and coenzyme A. The encoded protein is localized to mitochondria, has high specificity for malonate and methylmalonate and possesses malonyl-CoA synthetase activity. Mutations in this gene are a cause of combined malonic and methylmalonic aciduria. Alternatively spliced transcript variants have been observed for this gene.
Product OverviewMouse Anti-Cattle ACSF3 Antibody is a mouse antibody against ACSF3. It can be used for ACSF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl-CoA synthetase family member 3, mitochondrial; EC 6.2.1.-; ACSF3
UniProt IDQ58DN7
Protein RefseqThe length of the protein is 586 amino acids long.
The sequence is show below: MPLPYVGMALRRLAWAVASCRLAPWTRGASGPLHSAPAARSDCSAPVFIRAPAFGDRLALIDQHGRHTYKDLYLRSLRLSREICQLRACADGDLREERVSLLCSNDVSFVVAQWAAWMSGGVAVPLYRKHPRAQLEYFIQDSRSSVVLAGPEHVELLSPVAQKLGVPLLPLPPTVYHGVAEDPEEGLVLERNWRDRGAMIIYTSGTTGRPKGVLSTHDNIRAVVTGLVHKWAWTKDDVILHVLPLHHVHGVVNKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry