Mouse Anti-Cattle ACSL1 Antibody (MO-AB-06923R)


Cat: MO-AB-06923R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06923R
SpecificityThis antibody binds to Cattle ACSL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle ACSL1 Antibody is a mouse antibody against ACSL1. It can be used for ACSL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl-CoA synthetase long-chain family member 1; ACSL1
UniProt IDQ0VCZ8
Protein RefseqThe length of the protein is 699 amino acids long.
The sequence is show below: MMQAHELFQYFRLPELLDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPRALKPPCDLAMQSVEVPGSDGARRSTLLDSDEPLVYFYDDVRTLYEGFQRGLHVSNNGPCLGSRKPDQPYEWLSYKQVEDMAECVGSALLHKGFKAAPDQFIGIFAQNRPEWVIIEQGCFTYSMVIVPLYDTLGTEAITYIINKAELSLVFVDKPEKANLLLEGVENKLIPCLKTIVLMDSYGSDLLERGKKCGVEIISMKAMEDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry