Mouse Anti-Cattle ACSM1 Antibody (MO-AB-06928R)


Cat: MO-AB-06928R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO06928R
SpecificityThis antibody binds to Cattle ACSM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHas medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro). Functions as GTP-dependent lipoate-activating enzyme that generates the substrate for lipoyltransferase (By similarity).
Product OverviewMouse Anti-Cattle ACSM1 Antibody is a mouse antibody against ACSM1. It can be used for ACSM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcyl-coenzyme A synthetase ACSM1, mitochondrial; EC 6.2.1.2; Acyl-CoA synthetase medium-chain family member 1; Butyrate--CoA ligase 1; Butyryl-coenzyme A synthetase 1; Lipoate-activating enzyme; Middle-chain acyl-CoA synthetase 1; XL-III; Xenobiotic/mediu癷?癸ACSM1; BUCS1 LAE MACS1
UniProt IDQ9BEA2
Protein RefseqThe length of the protein is 577 amino acids long.
The sequence is show below: MQRLMKFRVLWGIHMSCPGFHHAPQHLRCRSLSGAGTLRWNDYDRPEEFNFASDVLDHWTQMEKEGKRSPNPALWWVNDQGDEVKWSFREMTDLTCRTANVLTQTCGLQTGDRLALILPRVPEWWLVCVGCIRTGIIFMPGTTQMKAKDILYRLQVSGAKAIVTTDTLAPEVESVAPECPSLKTKLLVSDHSREGWLDFRSLVKSASPDHICIKSKTLDPMAIFFTSGTTGFPKMAKHSHGFALRSYFPACRKLL.
See other products for " ACSM1 "
CBMOAB-35006FYAMouse Anti-Rhesus ACSM1 Antibody (CBMOAB-35006FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry