Mouse Anti-Cattle ADAMTS2 Antibody (MO-AB-07001R)


Cat: MO-AB-07001R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07001R
SpecificityThis antibody binds to Cattle ADAMTS2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) and ADAMTS-like protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene lacks the protease domain, and is therefore of a member of the the ADAMTS-like protein subfamily. It is a secreted glycoprotein that binds the cell surface and extracellular matrix; it also interacts with latent transforming growth factor beta binding protein 1. Mutations in this gene have been associated with geleophysic dysplasia.
Product OverviewMouse Anti-Cattle ADAMTS2 Antibody is a mouse antibody against ADAMTS2. It can be used for ADAMTS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesA disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM-TS 2; ADAM-TS2; ADAMTS-2; EC 3.4.24.14; Procollagen I N-proteinase; PC I-NP; Procollagen I/II amino propeptide-processing enzyme; Procollagen N-endopeptidase; pNPI; ADAMTS2; NPI
UniProt IDP79331
Protein RefseqThe length of the protein is 1205 amino acids long.
The sequence is show below: MDPPAGAAGRLLCPALLLLLLLPLPADARLAAAAADPPGGPQGHGAERILAVPVRTDAQGRLVSHVVSAATAPAGVRTRRAAPAQIPGLSGGSEEDPGGRLFYNVTVFGRDLHLRLRPNARLVAPGATVEWQGESGATRVEPLLGTCLYVGDVAGLAESSSVALSNCDGLAGLIRMEEEEFFIEPLEKGLAAKEAEQGRVHVVYHRPTTSRPPPLGGPQALDTGISADSLDSLSRALGVLEERVNSSRRRMRRHA.
For Research Use Only | Not For Clinical Use.
Online Inquiry