Mouse Anti-ADIPOR1 Antibody (MO-AB-07054R)


Cat: MO-AB-07054R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07054R Monoclonal Cattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus, Rice (Oryza), Sheep (Ovis aries) WB, ELISA MO07054R 100 µg
CBMOAB-00283FYA Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, IF, IHC, FC F00283FYA 100 µg
CBMOAB-18521FYB Monoclonal Rice (Oryza) WB, ELISA MO18521FYB 100 µg
MO-AB-09161W Monoclonal Cat (Felis catus) WB, ELISA MO09161W 100 µg
MO-AB-24664W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24664W 100 µg
MO-AB-34336W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34336W 100 µg
MO-AB-36673W Monoclonal Goat (Capra hircus) WB, ELISA MO36673W 100 µg
MO-AB-50500W Monoclonal Marmoset WB, ELISA MO50500W 100 µg
MO-AB-23569R Monoclonal Pig (Sus scrofa) WB, ELISA MO23569R 100 µg
MO-AB-01257H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01257C 100 µg
MO-AB-22813H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO22813C 100 µg
MO-AB-00057Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00057Y 100 µg
MO-AB-07093Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07093Y 100 µg
MO-AB-14094Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14094Y 100 µg
MO-NAB-00383W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, FC, IF, IHC, IHC-P NW0308 100 µg
MO-DKB-00943W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg
MO-DKB-03602W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, FC, IHC-P, IF, IHC ms2109-010 100 µg
MOFY-0722-FY94 Polyclonal Rhesus WB, IHC, ICC, IP 100 µg
MOFY-1222-FY124 Polyclonal Human, Mouse, Rat, Zebrafish FC, IF, IHC, ICC, WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Cat (Felis catus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus, Rice (Oryza), Sheep (Ovis aries)
CloneMO07054R
SpecificityThis antibody binds to Cattle ADIPOR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]
Product OverviewMouse Anti-Cattle ADIPOR1 Antibody is a mouse antibody against ADIPOR1. It can be used for ADIPOR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdiponectin receptor 1; ADIPOR1
UniProt IDQ3T0U4
Protein RefseqThe length of the protein is 375 amino acids long.
The sequence is show below: MSSHKGPAVAQGNGAPASNRAADTVELAELGPLLEEKGKRAVTSPTKAEEEQACPGPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFRSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQW.
For Research Use Only | Not For Clinical Use.
Online Inquiry