Mouse Anti-Cattle ADSS Antibody (MO-AB-07090R)
Cat: MO-AB-07090R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO07090R |
| Specificity | This antibody binds to Cattle ADSS. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes the enzyme adenylosuccinate synthetase which catalyzes the first committed step in the conversion of inosine monophosphate to adenosine monophosphate. A pseudogene of this gene is found on chromosome 17. |
| Product Overview | Mouse Anti-Cattle ADSS Antibody is a mouse antibody against ADSS. It can be used for ADSS detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Adenylosuccinate synthase, Fragment; ADSS |
| UniProt ID | Q6PWM0 |
| Protein Refseq | The length of the protein is 36 amino acids long. The sequence is show below: KPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDF. |
See other products for " ADSS "
| MO-AB-14129Y | Mouse Anti-Sheep ADSS Antibody (MO-AB-14129Y) |
| MO-AB-32809H | Mouse Anti-Nile tilapia ADSS Antibody (MO-AB-32809H) |
| MO-AB-07107Y | Mouse Anti-Rabbit ADSS Antibody (MO-AB-07107Y) |
| MO-AB-06266Y | Mouse Anti-O. anatinus ADSS Antibody (MO-AB-06266Y) |
| CBMOAB-00743FYA | Mouse Anti-D. melanogaster Adss Antibody (CBMOAB-00743FYA) |
| MO-AB-43599W | Mouse Anti-Horse ADSS Antibody (MO-AB-43599W) |
| MO-AB-42911W | Mouse Anti-Hamsters ADSS Antibody (MO-AB-42911W) |
| MO-AB-10603Y | Mouse Anti-O. mykiss ADSS Antibody (MO-AB-10603Y) |
| MO-AB-22819H | Mouse Anti-Mallard ADSS Antibody (MO-AB-22819H) |
| MO-AB-41192W | Mouse Anti-Guinea pig ADSS Antibody (MO-AB-41192W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry