Mouse Anti-Cattle AGXT2 Antibody (MO-AB-07146R)


Cat: MO-AB-07146R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07146R
SpecificityThis antibody binds to Cattle AGXT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor. It is an important regulator of methylarginines and is involved in the control of blood pressure in kidney. Polymorphisms in this gene affect methylarginine and beta-aminoisobutyrate metabolism, and are associated with carotid atherosclerosis. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle AGXT2 Antibody is a mouse antibody against AGXT2. It can be used for AGXT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlanine--glyoxylate aminotransferase 2, mitochondrial; AGXT2
UniProt IDF1MLG7
Protein RefseqThe length of the protein is 514 amino acids long.
The sequence is show below: MTGAWGHLLRSLHLKTLSLWIPKTCFSLKARAFWTSVTRCGLHTKPSMPPCDFTPERYQSLAYSRVLEIHKQHLSPVHTAYFPEPLLLHQGHVEWLFDHEGNRYLDFFSGIVTVSVGHCHPKVNAAAQRQLGRLWHTSSVFFHPLIHEYAEKLSALLPEPLKVVFLVNSGSEANDLAMLMARAHSNSTDIISFRGAYHGCSPYTLGLTNVGIYKMDLPHGMGCQPTMCPDIFHGPWGGSHCRDSPVQTIRKCSCA.
For Research Use Only | Not For Clinical Use.
Online Inquiry