Mouse Anti-Cattle ALB Antibody (MO-AB-07213R)
Cat: MO-AB-07213R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO07213R |
Specificity | This antibody binds to Cattle ALB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca, Na, K, fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc (By similarity). Major calcium and magnesium transporter in plasma, binds approximately 45% of circulating calcium and magnesium in plasma (By similarity). Potentially has more than two calcium-binding sites and might additionally bind calcium in a non-specific manner (By similarity). The shared binding site between zinc and calcium at residue Asp-273 suggests a crosstalk between zinc and calcium transport in the blood (By similarity). The rank order of affinity is zinc> calcium> magnesium (By similarity). Binds to the bacterial siderophore enterobactin and inhibits enterobactin-mediated iron uptake of E.coli from ferric transferrin, and may thereby limit the utilization of iron and growth of enteric bacteria such as E.coli (By similarity). Does not prevent iron uptake by the bacterial siderophore aerobactin (By similarity). |
Product Overview | Mouse Anti-Cattle ALB Antibody is a mouse antibody against ALB. It can be used for ALB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Serum albumin; BSA; allergen Bos d 6; ALB |
UniProt ID | P02769 |
Protein Refseq | The length of the protein is 607 amino acids long. The sequence is show below: MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEPERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVARLSQKFPKAEFVEVT. |
See other products for " Alb "
MO-AB-41208W | Mouse Anti-Guinea pig Alb Antibody (MO-AB-41208W) |
MO-AB-70619W | Mouse Anti-Cattle ALB Antibody (MO-AB-70619W) |
MOFY-0622-FY46 | Mouse Anti-ALB Antibody (MOFY-0622-FY46) |
MO-AB-22833H | Mouse Anti-Mallard alb Antibody (MO-AB-22833H) |
MOFY-0722-FY371 | FITC conjugated antibody to ALB Antibody (MOFY-0722-FY371) |
MO-AB-08669W | Mouse Anti-Cat ALB Antibody (MO-AB-08669W) |
MOFY-0722-FY375 | Rabbit Anti-ALB Antibody (MOFY-0722-FY375) |
CBMOAB-35472FYA | Mouse Anti-Rhesus ALB Antibody (CBMOAB-35472FYA) |
MOFY-0722-FY443 | Rabbit Anti-ALB Antibody (MOFY-0722-FY443) |
MO-AB-01345H | Mouse Anti-Frog alb Antibody (MO-AB-01345H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry