Mouse Anti-Cattle ALG8 Antibody (MO-AB-07252R)


Cat: MO-AB-07252R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07252R
SpecificityThis antibody binds to Cattle ALG8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Cattle ALG8 Antibody is a mouse antibody against ALG8. It can be used for ALG8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase; ALG8
UniProt IDF1MV61
Protein RefseqThe length of the protein is 526 amino acids long.
The sequence is show below: MAAFGIATGGSNWFSALALGVTLLKCLLIPTYHSTDFEVHRNWLAITHSLPISQWYYEATSEWTLDYPPFFAWFEYALSHVAKYFDQEMLNVRNLNYSSSRTLLFQRFSVIFTDALFVYAVHECCKCIDGKKAGKELTEKPKFILSALLLWNFGLLIVDHIHFQYNGFLSGLMLLSIARFFQKRHMEGAFLFAVLLHFKHIYLYVAPAYGVYLLRSYCFTANKQDGSIRWNSFSFVRLISLGLIVFLVSALSLGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry