Mouse Anti-Cattle AMOTL1 Antibody (MO-AB-07309R)


Cat: MO-AB-07309R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07309R
SpecificityThis antibody binds to Cattle AMOTL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a peripheral membrane protein that is a component of tight junctions or TJs. TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity. This protein is related to angiomotin, an angiostatin binding protein that regulates endothelial cell migration and capillary formation. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle AMOTL1 Antibody is a mouse antibody against AMOTL1. It can be used for AMOTL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAngiomotin-like protein 1; AMOTL1
UniProt IDE1BEQ5
Protein RefseqThe length of the protein is 960 amino acids long.
The sequence is show below: MLMLHVKRNTCEHTFKCPPPACYSPSSPVQILEDPSYFFPDFQLYPGRHEASLTVEANSSIREKVVEDPLCNFHPPNFPRIPEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNFSSTENLAQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSAQPQQNNEELPTYEEAKAQSQFFRGQQPPPPPPQQQPGAVGHSYYMAGGASQKARTEGRPTVSRANSGQAHKDEALKEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry