Mouse Anti-Cattle AMPD1 Antibody (MO-AB-07311R)


Cat: MO-AB-07311R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07311R
SpecificityThis antibody binds to Cattle AMPD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAdenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.
Product OverviewMouse Anti-Cattle AMPD1 Antibody is a mouse antibody against AMPD1. It can be used for AMPD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAMPD1 protein; AMPD1
UniProt IDA6QPA7
Protein RefseqThe length of the protein is 747 amino acids long.
The sequence is show below: MPLLKLPAEGKPIDDAMRSFAEKVFASEVKDEGGRHEISPFDVDDICPISQHEMFAHMFHLEAKSTPTETRRKRRFFGRKTISLSVPQTETSSTKLSLIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEMVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVEKENFYPVFTPPMKKGEDPFRTDNLPENLGYQLKMKDGVVYVYPNEEAASKDEPKPLPYPNLDTFLDDMNFLLALIAQGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry