Mouse Anti-Cattle ANGPT2 Antibody (MO-AB-07337R)


Cat: MO-AB-07337R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07337R
SpecificityThis antibody binds to Cattle ANGPT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-Cattle ANGPT2 Antibody is a mouse antibody against ANGPT2. It can be used for ANGPT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAngiopoietin-2; ANG-2; ANGPT2; ANG2
UniProt IDO77802
Protein RefseqThe length of the protein is 496 amino acids long.
The sequence is show below: MWQLVFLTLSCDLAVATAHSGSRKGMDIAAGKKQYQVQHGACSYTFLLPETDHCRSPSSAYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEISKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMET.
For Research Use Only | Not For Clinical Use.
Online Inquiry