Mouse Anti-Cattle AOX1 Antibody (MO-AB-07427R)


Cat: MO-AB-07427R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07427R
SpecificityThis antibody binds to Cattle AOX1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOxidase with broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide, N-methylphthalazinium and phthalazine, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. Plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. Participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent. Is probably involved in the regulation of reactive oxygen species homeostasis. May be a prominent source of superoxide generation via the one-electron reduction of molecular oxygen. Also may catalyze nitric oxide (NO) production via the reduction of nitrite to NO with NADH or aldehyde as electron donor. May play a role in adipogenesis. Cannot use hypoxanthine and all-trans-retinol as substrate.
Product OverviewMouse Anti-Cattle AOX1 Antibody is a mouse antibody against AOX1. It can be used for AOX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAldehyde oxidase 1; EC 1.2.3.1; Azaheterocycle hydroxylase 1; EC 1.17.3.-; AOX1; AO
UniProt IDP48034
Protein RefseqThe length of the protein is 1339 amino acids long.
The sequence is show below: MEGGSELLFYVNGRKVTEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKKIRHYPANACLTPICSLYGAAVTTVEGIGSTKTRIHPVQERIAKCHGTQCGFCTPGMVMSLYTLLRNHPEPTLTQLNDALGGNLCRCTGYRPIINACKTFCKTSGCCQSKENGVCCLDQGMNGLPEFEEGNETSLKLFSEEEFLPLDPTQELIFPPELMTMAEKKTQKTRIFGSDRMTWISPVTLKELLEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry