Mouse Anti-Cattle APOC4 Antibody (MO-AB-07498R)


Cat: MO-AB-07498R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07498R
SpecificityThis antibody binds to Cattle APOC4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a lipid-binding protein belonging to the apolipoprotein gene family. The protein is thought to play a role in lipid metabolism. Polymorphisms in this gene may influence circulating lipid levels and may be associated with coronary artery disease risk. This gene is present in a cluster with other related apolipoprotein genes on chromosome 19. Naturally occurring read-through transcription exists between this gene and the neighboring downstream apolipoprotein C-II (APOC2) gene.
Product OverviewMouse Anti-Cattle APOC4 Antibody is a mouse antibody against APOC4. It can be used for APOC4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesApolipoprotein C-IV; Apo-CIV; ApoC-IV; Apolipoprotein C4; APOC4
UniProt IDQ3SYR5
Protein RefseqThe length of the protein is 127 amino acids long.
The sequence is show below: MSFPGCRPQALASLCFCVLVLACVVACQQEEPEGTLSPQPAPARSSWSLVPGKVKEWVEPLVNRTREKWKWFWGPTAFRGFMETYYDDHLKDLGSRARAWLRSSKDNLLNKAHSLCPQLLCRPSDQN.
For Research Use Only | Not For Clinical Use.
Online Inquiry