Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September, the 10th Annual Immuno-Oncology Summit in October, and the Antibody Engineering & Therapeutics (US) 2022 in December for expert consultation on your drug discovery projects. Shoot an email to arrange an in-person meeting!

Mouse Anti-Cattle ARF4 Antibody (MO-AB-07538R)


Cat: MO-AB-07538R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07538R
SpecificityThis antibody binds to Cattle ARF4.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle ARF4 (clone MO07538R) Antibody (MO-AB-07538R) is a mouse antibody against ARF4. It can be used for ARF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP-ribosylation factor 4; ARF4
UniProt IDQ3SZF2
Protein RefseqThe length of the protein is 180 amino acids long.
The sequence is show below: MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIQEGAEELQKMLQEDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR.

See other products for " ARF4 "

MO-MMB-0476Rabbit Anti-ARF4 Antibody (Cat MO-MMB-0476)
CBMOAB-2552FYCMouse Anti-Arabidopsis ARF4 Antibody (CBMOAB-2552FYC)
MO-AB-14231YMouse Anti-Sheep ARF4 Antibody (MO-AB-14231Y)
CBMOAB-2554FYCMouse Anti-Arabidopsis ARF4 Antibody (CBMOAB-2554FYC)
CBMOAB-2559FYCMouse Anti-Arabidopsis ARF4 Antibody (CBMOAB-2559FYC)
CBMOAB-2561FYCMouse Anti-Arabidopsis ARF4 Antibody (CBMOAB-2561FYC)
CBMOAB-2555FYCMouse Anti-Arabidopsis ARF4 Antibody (CBMOAB-2555FYC)
MO-AB-10650YMouse Anti-O. mykiss ARF4 Antibody (MO-AB-10650Y)
MO-AB-47393WMouse Anti-Maize ARF4 Antibody (MO-AB-47393W)
MO-AB-23853RMouse Anti-Pig ARF4 Antibody (MO-AB-23853R)
For Research Use Only | Not For Clinical Use.

Online Inquiry