Mouse Anti-Cattle ASAH1 Antibody (MO-AB-07666R)


Cat: MO-AB-07666R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07666R
SpecificityThis antibody binds to Cattle ASAH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Lysosome; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the acid ceramidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. Processing of this preproprotein generates alpha and beta subunits that heterodimerize to form the mature lysosomal enzyme, which catalyzes the degradation of ceramide into sphingosine and free fatty acid. This enzyme is overexpressed in multiple human cancers and may play a role in cancer progression. Mutations in this gene are associated with the lysosomal storage disorder, Farber lipogranulomatosis, and a neuromuscular disorder, spinal muscular atrophy with progressive myoclonic epilepsy.
Product OverviewMouse Anti-Cattle ASAH1 Antibody is a mouse antibody against ASAH1. It can be used for ASAH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcid ceramidase; AC; ACDase; Acid CDase; EC 3.5.1.23; Acylsphingosine deacylase; N-acylsphingosine amidohydrolase; ASAH1
UniProt IDQ17QB3
Protein RefseqThe length of the protein is 395 amino acids long.
The sequence is show below: MLGWSRLTFILLSGIVTCLVAQQVPPWTEDCRKSTYPPSGPTYRGPVPWYTINLDLPPYKRWHELMVVKAPALKVIVNSMKNIVNAFVPSGKIIHLVDQKLPGLLGNFPGPFEEEMKGIAAVTEIPLGEIILFNIFYEFFTICTSIITEDKEGHLLHGRNLDFGVFLGWNINNDTWVITEELKPLTVNLDFQRNNKTLFKATTFAGYVGMLTGFKPGLFSVTLNERFSIDGGFMGVMEWILGKKDAQWVGFIIRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry