Mouse Anti-Cattle ASB12 Antibody (MO-AB-07670R)


Cat: MO-AB-07670R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07670R
SpecificityThis antibody binds to Cattle ASB12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation.
Product OverviewMouse Anti-Cattle ASB12 Antibody is a mouse antibody against ASB12. It can be used for ASB12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnkyrin repeat and SOCS box-containing 12, Fragment; ASB12
UniProt IDF5B2W0
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MDITKIFSLLQPDDEEDTNTGEKQALNQAVYNNDSYTLDQLLCQERYKRFINSRSGWGVPGTPLRLAAAYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGACPGGSIYNNCSPVLTAARDGAVTILQELLGHGAEVNVKAKLPVWASNITSCSGPLYLAAVYGHLDCFRLLLLHGADPDYICTDQRLLARVSRPRTLLEICLHHNCEPEYIQLLIDFGANIYLPSLCLDLNSQYDKGTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry