Mouse Anti-Cattle ATN1 Antibody (MO-AB-07766R)


Cat: MO-AB-07766R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07766R
SpecificityThis antibody binds to Cattle ATN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDentatorubral pallidoluysian atrophy (DRPLA) is a rare neurodegenerative disorder characterized by cerebellar ataxia, myoclonic epilepsy, choreoathetosis, and dementia. The disorder is related to the expansion from 7-35 copies to 49-93 copies of a trinucleotide repeat (CAG/CAA) within this gene. The encoded protein includes a serine repeat and a region of alternating acidic and basic amino acids, as well as the variable glutamine repeat. Alternative splicing results in two transcripts variants that encode the same protein.
Product OverviewMouse Anti-Cattle ATN1 Antibody is a mouse antibody against ATN1. It can be used for ATN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATN1 protein, Fragment; ATN1
UniProt IDA6QP47
Protein RefseqThe length of the protein is 690 amino acids long.
The sequence is show below: PPPHHGGSGPPPPGAYPHPLESGGSHHAHPYAMSPSLGSLRPYPPGPAHLPPPHSQVSYSQAGPNGPPTSSSSNSSSSSQGSYPGSHPSPSQGPSGAPYPFPPVPPVTTSSATLSTVIATVASSPAGYKTASPPGPPPYGKRAPSPGAYKTATPPGYKPGSPPSFRTGTPPGYRGASPPAGPGTFKPGSPTVGPGPLPPAGPSGLSSLPAPPAAPASGPPLSATQIKQEPAEEYETPESPVPPARSPSPPPKVVD.
For Research Use Only | Not For Clinical Use.
Online Inquiry