AibGenesis™ Mouse Anti-ATP6V1E2 Antibody (MO-AB-07858R)


Cat: MO-AB-07858R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07858R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO07858R 100 µg
Inquiry
MO-AB-24257H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24257C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO07858R
SpecificityThis antibody binds to Cattle ATP6V1E2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSubunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Cattle ATP6V1E2 Antibody is a mouse antibody against ATP6V1E2. It can be used for ATP6V1E2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesV-type proton ATPase subunit E 2; V-ATPase subunit E 2; Vacuolar proton pump subunit E 2; ATP6V1E2
UniProt IDQ32LB7
Protein RefseqThe length of the protein is 226 amino acids long.
The sequence is show below: MALSDVDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSTLRNQARLKVLRARNDLISELLNDAKLRLSRIVTDPEFYQGLLDKLVLQGLLRLLEPVVIVRCRPQDHFLVEAAVQRAIPQYTAVSHRCVEVQVDKEVQLATDTTGGVEVYSSDQRIMVSNTLESRLDLLSQQKMPEIRKALFGANANRKFFV.
For Research Use Only | Not For Clinical Use.
Online Inquiry