Mouse Anti-Cattle AUP1 Antibody (MO-AB-07898R)


Cat: MO-AB-07898R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO07898R
SpecificityThis antibody binds to Cattle AUP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded this gene is involved in several pathways including quality control of misfolded proteins in the endoplasmic reticulum and lipid droplet accumulation. Lipid droplets are organelles in the cytoplasm that store neutral lipids such as cholesterol esters and trigylycerides to prevent the overabundance of free cholesterol and fatty acids in cells, but also to act as storage for other metabolic processes, such as membrane biogenesis. Reduced expression of this gene results in reduced lipid droplet clustering, a function that is dependent on ubiquitination of the protein. This protein contains multiple domains including a hydrophobic N-terminal domain, an acetyltranferase domain, a ubiquitin-binding CUE domain, and a UBE2B2-binding domain (G2BR). Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cattle AUP1 Antibody is a mouse antibody against AUP1. It can be used for AUP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAncient ubiquitous protein 1; AUP1
UniProt IDQ3ZC65
Protein RefseqThe length of the protein is 410 amino acids long.
The sequence is show below: MEPPSSPGPERLFDSHRLPGDGFLLLALLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVFRRFVVRTMCAVLGLVARQEDSGLRDHRVRVLISNHVTPFDHNIVNLLTSCSTPLLNSPPSFVCWSRGFMEMDGQGELVESLKRFCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLRVQRPLVSVTVSDASWVSELLWSLFVPFTVYQVRWLRPVHRQLGEGSEEFALRVQQLVAKELGQT.
For Research Use Only | Not For Clinical Use.
Online Inquiry