Mouse Anti-Cattle BCAT2 Antibody (MO-AB-08004R)


Cat: MO-AB-08004R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO08004R
SpecificityThis antibody binds to Cattle BCAT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a branched chain aminotransferase found in mitochondria. The encoded protein forms a dimer that catalyzes the first step in the production of the branched chain amino acids leucine, isoleucine, and valine. Multiple transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Cattle BCAT2 Antibody is a mouse antibody against BCAT2. It can be used for BCAT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBranched-chain-amino-acid aminotransferase, mitochondrial; BCAT(m); EC 2.6.1.42; BCAT2
UniProt IDQ5EA40
Protein RefseqThe length of the protein is 393 amino acids long.
The sequence is show below: MATAALRQIWIPRFLPVPWFLCGSRRYASSSFKAADLQLEMTQEPHKKPDPSQPLLFGKTFTDHMLMVEWNQEKGWGQPRIQPFQNLTLHPACSALHYSLQLFEGMKAFKGGDQRVRLFRPWLNMERMLRSALRLCLPSFDKIELLECIRRLVEVDQDWVPGSMGTSLYVRPVLIGNEPSLGVGHPTRALLFVILSPVGAYFPGDALKPVSLLADPSFIRAWVGGVGNYKLGGNYGPTVLVQQEAQKKGCEQVLW.
See other products for " BCAT2 "
MO-AB-00155LMouse Anti-Elephant BCAT2 Antibody (MO-AB-00155L)
CBMOAB-67539FYAMouse Anti-Zebrafish bcat2 Antibody (CBMOAB-67539FYA)
MO-AB-07722WMouse Anti-Cat BCAT2 Antibody (MO-AB-07722W)
MO-AB-29218WMouse Anti-Dog BCAT2 Antibody (MO-AB-29218W)
MO-AB-24099RMouse Anti-Pig BCAT2 Antibody (MO-AB-24099R)
MO-AB-51796WMouse Anti-Marmoset BCAT2 Antibody (MO-AB-51796W)
MO-AB-41311WMouse Anti-Guinea pig BCAT2 Antibody (MO-AB-41311W)
MO-AB-43841WMouse Anti-Horse BCAT2 Antibody (MO-AB-43841W)
MO-AB-01818HMouse Anti-Frog bcat2 Antibody (MO-AB-01818H)
MO-AB-14354YMouse Anti-Sheep BCAT2 Antibody (MO-AB-14354Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry