AibGenesis™ Mouse Anti-Bcnt Antibody (MO-AB-08041R)


Cat: MO-AB-08041R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08041R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa) WB, ELISA MO08041R 100 µg
MO-AB-24116R Monoclonal Pig (Sus scrofa) WB, ELISA MO24116R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa)
CloneMO08041R
SpecificityThis antibody binds to Cattle Bcnt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle Bcnt Antibody is a mouse antibody against Bcnt. It can be used for Bcnt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCraniofacial development protein 1; Bcnt
UniProt IDS6CGB4
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MEEFDSEDFSTSEEDEDYVPSGGEYSEDDINELVKEDEVDGEEETQKTKGTKRKAESVLARKRKQGGLSLEEDEEDANEESGGSSSEEEDAATEQQKGVESEDARKKKEDELWASFLNDVGPKSKVPPSTHVKTGEETEETSSSHLVKAERLEKPKETEKVKITKVFDFAGEEVRLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMS.
For Research Use Only | Not For Clinical Use.
Online Inquiry