Mouse Anti-Cattle BPIFB1 Antibody (MO-AB-09111R)


Cat: MO-AB-09111R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09111R
SpecificityThis antibody binds to Cattle BPIFB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene may be involved in the innate immune response to bacterial exposure in the mouth, nasal cavities, and lungs. The encoded protein is secreted and is a member of the BPI/LBP/PLUNC protein superfamily. This gene is found with other members of the superfamily in a cluster on chromosome 20.
Product OverviewMouse Anti-Cattle BPIFB1 Antibody is a mouse antibody against BPIFB1. It can be used for BPIFB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBPI fold-containing family B member 1; Long palate, lung and nasal epithelium carcinoma-associated protein 1; Von Ebner minor salivary gland protein; VEMSGP; BPIFB1; LPLUNC1
UniProt IDQ8SPF8
Protein RefseqThe length of the protein is 473 amino acids long.
The sequence is show below: MAYPWTFTFLCGLLAANLVGATLSPPVVLSLSTEVIKQMLAQKLKNHDVTNTLQQLPLLTAMEEESSRGIFGNLVKSILKHILWMKVTSASIGQLQVQPLANGRQLMVKAPLDVVAGFNVPLFKTVVELHVEVEAQAIIHVETREKDHARLVLSECSNTGGSLRVSLLHKLSFLLKCLADKVISLLTPAPPKLVKSELCPVLKAGFEDMRGELLNLTKVPMSLNSEHLKLDFISPVIDHSVVHLILGARLFNSEG.
For Research Use Only | Not For Clinical Use.
Online Inquiry