Mouse Anti-Cattle CALB1 Antibody (MO-AB-09415R)


Cat: MO-AB-09415R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09415R
SpecificityThis antibody binds to Cattle CALB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCALB1 (Calbindin 1) is a Protein Coding gene. Diseases associated with CALB1 include Huntington Disease and Temporal Lobe Epilepsy. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Endocrine and other factor-regulated calcium reabsorption. Gene Ontology (GO) annotations related to this gene include calcium ion binding and vitamin D binding. An important paralog of this gene is CALB2.
Product OverviewMouse Anti-Cattle CALB1 Antibody is a mouse antibody against CALB1. It can be used for CALB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalbindin; Calbindin D28; D-28K; Vitamin D-dependent calcium-binding protein, avian-type; CALB1
UniProt IDP04467
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGVKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNIPTYKKSIMALSDGGKLYRTDLALI.
For Research Use Only | Not For Clinical Use.
Online Inquiry