Mouse Anti-Cattle CCK Antibody (MO-AB-09682R)


Cat: MO-AB-09682R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09682R
SpecificityThis antibody binds to Cattle CCK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCK (Cholecystokinin) is a Protein Coding gene. Diseases associated with CCK include Biliary Dyskinesia and Cholecystitis. Among its related pathways are Cell-type Dependent Selectivity of CCK2R Signaling and Peptide ligand-binding receptors. Gene Ontology (GO) annotations related to this gene include hormone activity and neuropeptide hormone activity.
Product OverviewMouse Anti-Cattle CCK Antibody is a mouse antibody against CCK. It can be used for CCK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCholecystokinin; CCK; [Cleaved into: Cholecystokinin-58 (CCK58); Cholecystokinin-58 desnonopeptide ((1-49)-CCK58); Cholecystokinin-39 (CCK39); Cholecystokinin-33 (CCK33); Cholecystokinin-25 (CCK25); Cholecystokinin-18 (CCK18); Cholecystokinin-12 (CCK12); 癷?癸CCK
UniProt IDP41520
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: MNRGVCLCLLMAVLAAGALAQPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry