Mouse Anti-Cattle CCT8 Antibody (MO-AB-09766R)


Cat: MO-AB-09766R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09766R
SpecificityThis antibody binds to Cattle CCT8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCT8 (Chaperonin Containing TCP1 Subunit 8) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Innate Immune System. Gene Ontology (GO) annotations related to this gene include unfolded protein binding and ATPase activity, coupled. An important paralog of this gene is CCT8L2.
Product OverviewMouse Anti-Cattle CCT8 Antibody is a mouse antibody against CCT8. It can be used for CCT8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-complex protein 1 subunit theta; TCP-1-theta; CCT-theta; CCT8
UniProt IDQ3ZCI9
Protein RefseqThe length of the protein is 548 amino acids long.
The sequence is show below: MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRLGLSVSEVIEGYEIACKKAHEILPDLVCCSAKNLRDVDEVSSLLHTSVMSKQYGNEVFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGVHSSSVLHGMVFKKETEGDVTSVKDAKIAVYSCPFDGMITETKG.
See other products for " CCT8 "
MO-AB-01034YMouse Anti-Chicken CCT8 Antibody (MO-AB-01034Y)
MO-AB-10828YMouse Anti-O. mykiss CCT8 Antibody (MO-AB-10828Y)
CBMOAB-01153HCBMouse Anti-C. elegans CCT8 Antibody (CBMOAB-01153HCB)
MO-AB-12584WMouse Anti-Chimpanzee CCT8 Antibody (MO-AB-12584W)
MO-AB-52520WMouse Anti-Marmoset CCT8 Antibody (MO-AB-52520W)
MO-DKB-01423WRabbit Anti-CCT8 Antibody (MO-DKB-01423W)
CBMOAB-00640CRMouse Anti-Yeast CCT8 Antibody (CBMOAB-00640CR)
CBMOAB-69650FYAMouse Anti-Zebrafish cct8 Antibody (CBMOAB-69650FYA)
CBMOAB-38617FYAMouse Anti-Rhesus CCT8 Antibody (CBMOAB-38617FYA)
CBMOAB-25878FYCMouse Anti-Arabidopsis CCT8 Antibody (CBMOAB-25878FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry