Mouse Anti-Cattle CD320 Antibody (MO-AB-09816R)


Cat: MO-AB-09816R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09816R
SpecificityThis antibody binds to Cattle CD320.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD320 (CD320 Molecule) is a Protein Coding gene. Diseases associated with CD320 include Methylmalonic Aciduria, Transient, Due To Transcobalamin Receptor Defect and Methylmalonic Acidemia Due To Transcobalamin Receptor Defect. Among its related pathways are Diseases of metabolism and Metabolism. Gene Ontology (GO) annotations related to this gene include growth factor activity and cobalamin binding.
Product OverviewMouse Anti-Cattle CD320 Antibody is a mouse antibody against CD320. It can be used for CD320 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD320 antigen; Transcobalamin receptor; TCblR; CD antigen CD320; CD320
UniProt IDA6QNY1
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MNGWVARGLARRAAALGLGLRVLLCFGLCLEIAPTPIQTWSPTQAPGPSAGSCPPTNFQCRSDGRCLPLIWRCDVDQDCPDGSDEEECGTEVPNGSPSPCDIMDDCPDHNKNLLNCGPQSCPEGELCCPLDGVCIPSTWLCDGHRDCSDYSDELGCGTKTHEEGRTMSTGTPVTLENVTYLSNATVTAIEDWDSVQSGNRNVYGIIAAVAVLSISLAAGILFALSRLCAQGCLAPLGLLVSMKGSLQPEKKTSVL.
See other products for " CD320 "
For Research Use Only | Not For Clinical Use.
Online Inquiry