Mouse Anti-Cattle CD3D Antibody (MO-AB-09823R)


Cat: MO-AB-09823R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09823R
SpecificityThis antibody binds to Cattle CD3D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD3D (CD3d Molecule) is a Protein Coding gene. Diseases associated with CD3D include Immunodeficiency 19 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Toll-like receptor signaling pathway. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and transmembrane signaling receptor activity. An important paralog of this gene is CD3G.
Product OverviewMouse Anti-Cattle CD3D Antibody is a mouse antibody against CD3D. It can be used for CD3D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d; CD3D
UniProt IDQ28072
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MEHSRFLSCLILAALLSQVNPRILKVLEPEDKVMLECNSSITLLQGTEGQEVSGNNKTRDLGKRIQDPRGMYRCGENTQQLILQVYYRMCQNCVELDTATLAGMIITDIIATVLLALGVYCFAGHETGRFSRAADTQALMGNDQLYQPLRERNDAQYSRLGDKWARNK.

Reference

Reference1. Li, L., Teale, A., Bensaid, A., Dunlap, S., Dietz, A. B., & Womack, J. E. (1992). Somatic cell mapping of T-cell receptor CD3 complex and CD8 genes in cattle. Immunogenetics, 36, 224-229.
2. Li, L. (1993). Physical mapping of two multi-gene families and comparative anchor loci in cattle and genetic linkage analysis on cattle chromosome 6. Texas A&M University.
See other products for " CD3D "
MO-AB-14496YMouse Anti-Sheep CD3D Antibody (MO-AB-14496Y)
MOFY-0622-FY158Rabbit Anti-CD3d Antibody (MOFY-0622-FY158)
MO-AB-01055YMouse Anti-Chicken CD3D Antibody (MO-AB-01055Y)
MOFY-0722-FY287Rabbit Anti-CD3d Antibody (MOFY-0722-FY287)
MO-AB-24451RMouse Anti-Pig CD3D Antibody (MO-AB-24451R)
MO-AB-24636HMouse Anti-Rat Cd3d Antibody (MO-AB-24636H)
CBMOAB-38699FYAMouse Anti-Rhesus CD3D Antibody (CBMOAB-38699FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry