Mouse Anti-Cattle CD46 Antibody (MO-AB-09853R)


Cat: MO-AB-09853R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09853R
SpecificityThis antibody binds to Cattle CD46.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD46 (CD46 Molecule) is a Protein Coding gene. Diseases associated with CD46 include Hemolytic Uremic Syndrome, Atypical 2 and Measles. Among its related pathways are Creation of C4 and C2 activators and Complement and coagulation cascades. Gene Ontology (GO) annotations related to this gene include receptor activity and enzyme inhibitor activity. An important paralog of this gene is C4BPA.
Product OverviewMouse Anti-Cattle CD46 Antibody is a mouse antibody against CD46. It can be used for CD46 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplement regulatory protein variant; CD46
UniProt IDA0A075TEJ1
Protein RefseqThe length of the protein is 434 amino acids long.
The sequence is show below: MRASCTPLKAPLRRPERLASSGRFAWVLLLAPLLLLPTSSDACDDPPRFVSMKPQGTLKPSYSPGEQIVYECRLGFQPVTPGQVLALVCQDNNTWSSLQEGCKKRRCPTLADPTNGQVILVNGSTAFGSEVHYVCNNGYYLLGTNISYCEVSSGTGVNWSDNPPTCEKILCQPPPEIQNGKYTNSHKDVFEYNEVVTYSCDPSNGPDEYSLVGESKLTCIGNGEWSSQPPQCKVVKCVYPAIEHGTIVSGFGPKY.
For Research Use Only | Not For Clinical Use.
Online Inquiry