Mouse Anti-Cattle CD47 Antibody (MO-AB-09867R)


Cat: MO-AB-09867R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09867R
SpecificityThis antibody binds to Cattle CD47.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD47 (CD47 Molecule) is a Protein Coding gene. Diseases associated with CD47 include Hereditary Spherocytosis and Neonatal Meningitis. Among its related pathways are Response to elevated platelet cytosolic Ca2+ and Innate Immune System. Gene Ontology (GO) annotations related to this gene include thrombospondin receptor activity.
Product OverviewMouse Anti-Cattle CD47 Antibody is a mouse antibody against CD47. It can be used for CD47 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47; CD47
UniProt IDQ9N0K1
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: MWPLVVVLLLGSVRCGSAQLIFNAIKSVEYTLCNQTVVIPCFVNNVETKNITELYVRWKFKGENIFIFDGSQRMSKPSSNFSSAEIAPSELLRGIASLKMAKSDAVLGNYTCEVTELSREGETIIELKYRVVSWFSPNENILIVIFPVLAILLFWGQFGIVTLKYKSNYTKEKAIFLLVAGLLLTVLVIVGAFLFIPGGYSTKNASGLGLIVLPTIILILLHYCVFMIAMGMSSFTISILILQLLGYVLSVVGFS.

Reference

Reference1. Caston, S. S., Cooper, E. E., Chandramani-Shivalingappa, P., Sponseller, B. A., Hostetter, J. M., & Sun, Y. (2016). CD47 expression in cryopreserved equine cutaneous masses and normal skin. Journal of Veterinary Diagnostic Investigation, 28(4), 408-413.
2. Oldenborg, P. A. (2013). CD47: a cell surface glycoprotein which regulates multiple functions of hematopoietic cells in health and disease. International Scholarly Research Notices, 2013.
For Research Use Only | Not For Clinical Use.
Online Inquiry