Mouse Anti-Cattle CD47 Antibody (MO-AB-09867R)


Cat: MO-AB-09867R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09867R
SpecificityThis antibody binds to Cattle CD47.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CD47 (clone MO09867R) Antibody (MO-AB-09867R) is a mouse antibody against CD47. It can be used for CD47 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47; CD47
UniProt IDQ9N0K1
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: MWPLVVVLLLGSVRCGSAQLIFNAIKSVEYTLCNQTVVIPCFVNNVETKNITELYVRWKFKGENIFIFDGSQRMSKPSSNFSSAEIAPSELLRGIASLKMAKSDAVLGNYTCEVTELSREGETIIELKYRVVSWFSPNENILIVIFPVLAILLFWGQFGIVTLKYKSNYTKEKAIFLLVAGLLLTVLVIVGAFLFIPGGYSTKNASGLGLIVLPTIILILLHYCVFMIAMGMSSFTISILILQLLGYVLSVVGFS.
For Research Use Only | Not For Clinical Use.

Online Inquiry