AibGenesis™ Mouse Anti-CD47 Antibody (MO-AB-09867R)


Cat: MO-AB-09867R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
  • Reference
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09867R Monoclonal Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO09867R 100 µg
CBMOAB-00045FYA Monoclonal Cattle (Bos taurus) FC F00045FYA 100 µg
CBMOAB-38723FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO38723FYA 100 µg
MO-AB-26561W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26561W 100 µg
MO-AB-52571W Monoclonal Marmoset WB, ELISA MO52571W 100 µg
MO-AB-01063Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01063Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO09867R
SpecificityThis antibody binds to Cattle CD47.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CD47 Antibody is a mouse antibody against CD47. It can be used for CD47 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeukocyte surface antigen CD47; Integrin-associated protein; IAP; CD antigen CD47; CD47
UniProt IDQ9N0K1
Protein RefseqThe length of the protein is 303 amino acids long.
The sequence is show below: MWPLVVVLLLGSVRCGSAQLIFNAIKSVEYTLCNQTVVIPCFVNNVETKNITELYVRWKFKGENIFIFDGSQRMSKPSSNFSSAEIAPSELLRGIASLKMAKSDAVLGNYTCEVTELSREGETIIELKYRVVSWFSPNENILIVIFPVLAILLFWGQFGIVTLKYKSNYTKEKAIFLLVAGLLLTVLVIVGAFLFIPGGYSTKNASGLGLIVLPTIILILLHYCVFMIAMGMSSFTISILILQLLGYVLSVVGFS.

Reference

Reference1. Caston, S. S., Cooper, E. E., Chandramani-Shivalingappa, P., Sponseller, B. A., Hostetter, J. M., & Sun, Y. (2016). CD47 expression in cryopreserved equine cutaneous masses and normal skin. Journal of Veterinary Diagnostic Investigation, 28(4), 408-413.
2. Oldenborg, P. A. (2013). CD47: a cell surface glycoprotein which regulates multiple functions of hematopoietic cells in health and disease. International Scholarly Research Notices, 2013.
For Research Use Only | Not For Clinical Use.
Online Inquiry