Mouse Anti-Cattle CDK12 Antibody (MO-AB-09968R)


Cat: MO-AB-09968R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09968R
SpecificityThis antibody binds to Cattle CDK12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCDK12 (Cyclin Dependent Kinase 12) is a Protein Coding gene. Diseases associated with CDK12 include Corneal Endothelial Dystrophy. Among its related pathways are Gene Expression and DNA Damage. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is CDK13.
Product OverviewMouse Anti-Cattle CDK12 Antibody is a mouse antibody against CDK12. It can be used for CDK12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCyclin-dependent kinase 12; CDK12
UniProt IDG5E518
Protein RefseqThe length of the protein is 1492 amino acids long.
The sequence is show below: MPNPERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLGSKHKRHKSKHSKDMGLVTPEAAPLGTVIKPLVEYDDISSDSDTFSDDLAFKVDRRENDERRGTDRSDRLHKHRHHQHRRTRDLLKTKQTEKEKNLEASSKSGSTKDRISGSSKRSNEENDDHGKAQISKSSNKESRSSKLHKEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSPKQDDSPSGASYGQDYDLSPPRSHT.
For Research Use Only | Not For Clinical Use.
Online Inquiry