Mouse Anti-Cattle CDS2 Antibody (MO-AB-10007R)
Cat: MO-AB-10007R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO10007R |
Specificity | This antibody binds to Cattle CDS2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Mitochondrion; Endoplasmic reticulum |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13. Provides CDP-diacylglycerol, an important precursor for the synthesis of phosphatidylinositol, phosphatidylglycerol, and cardiolipin. |
Product Overview | Mouse Anti-Cattle CDS2 Antibody is a mouse antibody against CDS2. It can be used for CDS2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Phosphatidate cytidylyltransferase 2; EC 2.7.7.41; CDP-DAG synthase 2; CDP-DG synthase 2; CDP-diacylglycerol synthase 2; CDS 2; CDP-diglyceride pyrophosphorylase 2; CDP-diglyceride synthase 2; CTP:phosphatidate cytidylyltransferase 2; CDS2 |
UniProt ID | A0JNC1 |
Protein Refseq | The length of the protein is 445 amino acids long. The sequence is show below: MTELRQRVAREPEAPPEDKESESEAKADGETASDSESRVEAVTQPPSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLS. |
See other products for " CDS2 "
MO-AB-34543W | Mouse Anti-Ferret CDS2 Antibody (MO-AB-34543W) |
MO-AB-23032H | Mouse Anti-Mallard CDS2 Antibody (MO-AB-23032H) |
MO-AB-52754W | Mouse Anti-Marmoset CDS2 Antibody (MO-AB-52754W) |
MO-AB-00202L | Mouse Anti-Elephant CDS2 Antibody (MO-AB-00202L) |
MO-AB-14527Y | Mouse Anti-Sheep CDS2 Antibody (MO-AB-14527Y) |
MO-AB-09699W | Mouse Anti-Cat CDS2 Antibody (MO-AB-09699W) |
MO-AB-24549R | Mouse Anti-Pig CDS2 Antibody (MO-AB-24549R) |
MO-AB-07554Y | Mouse Anti-Rabbit CDS2 Antibody (MO-AB-07554Y) |
MO-AB-41382W | Mouse Anti-Guinea pig CDS2 Antibody (MO-AB-41382W) |
CBMOAB-38886FYA | Mouse Anti-Rhesus CDS2 Antibody (CBMOAB-38886FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry