Mouse Anti-Cattle CHD4 Antibody (MO-AB-10151R)


Cat: MO-AB-10151R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10151R
SpecificityThis antibody binds to Cattle CHD4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Cattle CHD4 Antibody is a mouse antibody against CHD4. It can be used for CHD4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCHD4 protein, Fragment; CHD4
UniProt IDA7E3C8
Protein RefseqThe length of the protein is 354 amino acids long.
The sequence is show below: MASGLGSPSPCSAGSEEDDMDALLNNSLPPPHPENEEDPEEDLSEAETPKLKKKKKPKKPRDPKIPKSKRQKKERLLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEDEDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVESMVTATEVAPPPPPVEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry