Mouse Anti-Cattle CHST15 Antibody (MO-AB-10223R)


Cat: MO-AB-10223R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10223R
SpecificityThis antibody binds to Cattle CHST15.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionChondroitin sulfate (CS) is a glycosaminoglycan which is an important structural component of the extracellular matrix and which links to proteins to form proteoglycans. Chondroitin sulfate E (CS-E) is an isomer of chondroitin sulfate in which the C-4 and C-6 hydroxyl groups are sulfated. This gene encodes a type II transmembrane glycoprotein that acts as a sulfotransferase to transfer sulfate to the C-6 hydroxal group of chondroitin sulfate. This gene has also been identified as being co-expressed with RAG1 in B-cells and as potentially acting as a B-cell surface signaling receptor. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Cattle CHST15 Antibody is a mouse antibody against CHST15. It can be used for CHST15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSulfotransferase; EC 2.8.2.-; CHST15
UniProt IDE1BFV8
Protein RefseqThe length of the protein is 561 amino acids long.
The sequence is show below: MRHCINCCIQLSPDDVQTQQVSCRGSSHHGRQECPVCKAENKIVFRVDGKQMNLLAVLEVRADGNESWGGFLRFKKGKRCSLIFGLIIMTLVMASYILSGVHQELLISSPFHYGAFPSNPSLMEGENPSDAKEHHHQSSVNNISYMKDYPSIKLIINSITSRIEFTTRQLPDVEDLKKQELHMFSVIPHKFLPNSKSPCWYEEFTGRNTTDPYLTNSYVLYSKRFRSTFDTLRKAFWGHLSHAHGKHFRLRCLPH.
For Research Use Only | Not For Clinical Use.
Online Inquiry