Mouse Anti-Cattle COL8A1 Antibody (MO-AB-10530R)


Cat: MO-AB-10530R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10530R
SpecificityThis antibody binds to Cattle COL8A1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMacromolecular component of the subendothelium. Major component of the Descemet''s membrane (basement membrane) of corneal endothelial cells. Also component of the endothelia of blood vessels. Necessary for migration and proliferation of vascular smooth muscle cells and thus, has a potential role in the maintenance of vessel wall integrity and structure, in particular in atherogenesis (By similarity).
Product OverviewMouse Anti-Cattle COL8A1 Antibody is a mouse antibody against COL8A1. It can be used for COL8A1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOL8A1 protein; COL8A1
UniProt IDA7E303
Protein RefseqThe length of the protein is 745 amino acids long.
The sequence is show below: MAGPPSPLQLLGVLLTLSVGSIRLIHAGAYYGIKPLPPQIPAQIPPQIPQYQPLGQQVPHMPLGKDGLNVGKELPHMQYGKEYPHLPQYRKEVQPAPRMGKEAAPKKGKEIPLASLRGEQGPRGEPGPRGPPGPPGLPGQGIPGVKGKPGPQGYPGIGKPGMPGMPGKPGAMGMPGAKGEIGPKGEIGPMGIPGPQGPPGPHGLPGIGKPGGPGLPGQPGAKGERGPKGPPGPPGLQGPKGEKGFGMPGLPGLKG.
For Research Use Only | Not For Clinical Use.
Online Inquiry