Mouse Anti-Cattle COLEC12 Antibody (MO-AB-10532R)


Cat: MO-AB-10532R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10532R
SpecificityThis antibody binds to Cattle COLEC12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOLEC12 (Collectin Subfamily Member 12) is a Protein Coding gene. Diseases associated with COLEC12 include Syndromic X-Linked Intellectual Disability Snyder Type. Among its related pathways are Phagosome and Binding and Uptake of Ligands by Scavenger Receptors. Gene Ontology (GO) annotations related to this gene include scavenger receptor activity and signaling pattern recognition receptor activity. An important paralog of this gene is SCARA3.
Product OverviewMouse Anti-Cattle COLEC12 Antibody is a mouse antibody against COLEC12. It can be used for COLEC12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCollectin-12; Collectin placenta protein 1; CL-P1; COLEC12; CLP1
UniProt IDA6QP79
Protein RefseqThe length of the protein is 742 amino acids long.
The sequence is show below: MKDDFAEEEEVHSFGYKRFGIQEGTQCTKCKNNWALKLSIILLYILCALLTITVAILGYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKALSTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQSQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDT.
For Research Use Only | Not For Clinical Use.
Online Inquiry