Mouse Anti-Cattle COX10 Antibody (MO-AB-10611R)


Cat: MO-AB-10611R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO10611R
SpecificityThis antibody binds to Cattle COX10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion; Cytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOX10 (COX10, Heme A:Farnesyltransferase Cytochrome C Oxidase Assembly Factor) is a Protein Coding gene. Diseases associated with COX10 include Mitochondrial Complex Iv Deficiency and Leigh Syndrome. Among its related pathways are Metabolism and Porphyrin and chlorophyll metabolism. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity and prenyltransferase activity.
Product OverviewMouse Anti-Cattle COX10 Antibody is a mouse antibody against COX10. It can be used for COX10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtoheme IX farnesyltransferase, mitochondrial; EC 2.5.1.-; Heme O synthase; COX10
UniProt IDA5D7D6
Protein RefseqThe length of the protein is 443 amino acids long.
The sequence is show below: MAASPHTLSSRLLTGWGGGCIWYLERRVTRESPRRFLHLLRNVNQQWVTFQHFNFLRHMYVTQLNRSLKQQIKPKPEPAESPFLEKTSLDEAKAEICEMRPLVPPSLSLSRKPSEKALIEPEPTSVIEGSIDLGKETKEEKQWKEMKLRVDDLPGILARLSKIKLTALVVSTTSAGFALAPAPFDWSCFLLTFVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFATCCAVPGVALLTWGV.
For Research Use Only | Not For Clinical Use.
Online Inquiry